PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G134000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 257aa    MW: 27063.2 Da    PI: 6.2638
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G134000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEde l  +v+++G+g +W + +++ g++R++k+c++rw++yl
  Sevir.5G134000.1.p 14 RGPWSPEEDEALRSYVQRHGSGgNWISMPKKAGLKRCGKSCRLRWLNYL 62
                        89*********************************************97 PP

2Myb_DNA-binding45.41.9e-1469111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T eEd  +v + +qlG++ W++Ia+ +  gRt++++k++w++
  Sevir.5G134000.1.p  69 GGFTDEEDAVIVSLYTQLGSK-WSLIASQLE-GRTDNDVKNYWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.854962IPR017930Myb domain
SuperFamilySSF466891.43E-2712109IPR009057Homeodomain-like
SMARTSM007171.9E-121364IPR001005SANT/Myb domain
PfamPF002492.0E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-241569IPR009057Homeodomain-like
CDDcd001676.29E-101662No hitNo description
PROSITE profilePS5129421.74763117IPR017930Myb domain
SMARTSM007176.3E-1167115IPR001005SANT/Myb domain
PfamPF002492.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2370117IPR009057Homeodomain-like
CDDcd001672.20E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRTPCCDRA AVKRGPWSPE EDEALRSYVQ RHGSGGNWIS MPKKAGLKRC GKSCRLRWLN  60
YLRPDIRHGG FTDEEDAVIV SLYTQLGSKW SLIASQLEGR TDNDVKNYWN TKLKKRLLAA  120
AATADVVSTR SPPPVLRLAA APGPTPASSL FPSLAIPTVK TETYTCDDFL APTAFRDDDP  180
FAVAGGSADA AAADGSTSAS AASSASNWSA DNGAVGDGEG SYLLDFCTGS GIGGADGHLQ  240
LPGGYYYPLD PTLSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141177108B-MYB
1h8a_C4e-231211725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794161e-166HF679416.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB10 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968503.10.0PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL74e-68RAX2_ARATH; Transcription factor RAX2
TrEMBLK3XL560.0K3XL56_SETIT; Uncharacterized protein
STRINGSi002629m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.12e-63MYB family protein